SCOPe 2.08: Domain d2bq4b_: 2bq4 B:

Lineage for d2bq4b_ (2bq4 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.0: automated matches [227152] (1 protein)
   not a true family

6. Protein automated matches [226857] (5 species)
   not a true protein

7. Species Desulfovibrio africanus [TaxId:873] [224981] (1 PDB entry)

8. Domain d2bq4b_: 2bq4 B: [203632]
   automated match to d1gyoa_
   complexed with ca, hec

Details for d2bq4b_

PDB Entry: 2bq4, 1.68 Å

PDB Description: crystal structure of type i cytochrome c3 from desulfovibrio africanus

PDB Compounds: (B:) basic cytochrome c3

SCOPe Domain Sequences for d2bq4b_:

Sequence; same for both SEQRES and ATOM records:

>d2bq4b_ a.138.1.0 (B:) automated matches {Desulfovibrio africanus [TaxId: 873]}
pqvpadvvidhlsnpnakleykvkfshkahaslgtdaaacqkchhkwdgkseiggcateg
chadttsfkatekdpkflmtafhskspmscqgchkemktakkttgptacaqchnq

Timeline for d2bq4b_:

• d2bq4b_ first appeared in SCOPe 2.03
  
• d2bq4b_ appears in SCOPe 2.07