SCOPe 2.03: Domain d2bq4a_: 2bq4 A:

Lineage for d2bq4a_ (2bq4 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.0: automated matches [227152] (1 protein)
   not a true family

6. Protein automated matches [226857] (2 species)
   not a true protein

7. Species Desulfovibrio africanus [TaxId:873] [224981] (1 PDB entry)

8. Domain d2bq4a_: 2bq4 A: [203631]
   automated match to d1gyoa_
   complexed with ca, hec

Details for d2bq4a_

PDB Entry: 2bq4, 1.68 Å

PDB Description: crystal structure of type i cytochrome c3 from desulfovibrio africanus

PDB Compounds: (A:) basic cytochrome c3

SCOPe Domain Sequences for d2bq4a_:

Sequence; same for both SEQRES and ATOM records:

>d2bq4a_ a.138.1.0 (A:) automated matches {Desulfovibrio africanus [TaxId: 873]}
pqvpadvvidhlsnpnakleykvkfshkahaslgtdaaacqkchhkwdgkseiggcateg
chadttsfkatekdpkflmtafhskspmscqgchkemktakkttgptacaqchn

Timeline for d2bq4a_:

• d2bq4a_ is new in SCOPe 2.03-stable
  
• d2bq4a_ appears in SCOPe 2.04
  
• d2bq4a_ appears in the current release, SCOPe 2.08