SCOPe 2.04: Domain d2bpib2: 2bpi B:84-197

Lineage for d2bpib2 (2bpi B:84-197)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225154] (1 PDB entry)

8. Domain d2bpib2: 2bpi B:84-197 [203630]
   Other proteins in same PDB: d2bpia1, d2bpib1
   automated match to d1dt0a2
   complexed with fe

Details for d2bpib2

PDB Entry: 2bpi, 2.52 Å

PDB Description: structure of iron dependent superoxide dismutase from p. falciparum.

PDB Compounds: (B:) fe-superoxide dismutase

SCOPe Domain Sequences for d2bpib2:

Sequence; same for both SEQRES and ATOM records:

>d2bpib2 d.44.1.0 (B:84-197) automated matches {Plasmodium falciparum [TaxId: 36329]}
cggephgeikekiqedfgsfnnfkeqfsnilcghfgsgwgwlalnnnnklvilqthdagn
pikdntgipiltcdiwehayyidyrndrasyvkawwnlvnwnfanenlkkamqk

Timeline for d2bpib2:

• d2bpib2 first appeared in SCOPe 2.03
  
• d2bpib2 appears in SCOPe 2.05
  
• d2bpib2 appears in the current release, SCOPe 2.08