![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [225154] (1 PDB entry) |
![]() | Domain d2bpib2: 2bpi B:84-197 [203630] Other proteins in same PDB: d2bpia1, d2bpib1 automated match to d1dt0a2 complexed with fe |
PDB Entry: 2bpi (more details), 2.52 Å
SCOPe Domain Sequences for d2bpib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpib2 d.44.1.0 (B:84-197) automated matches {Plasmodium falciparum [TaxId: 36329]} cggephgeikekiqedfgsfnnfkeqfsnilcghfgsgwgwlalnnnnklvilqthdagn pikdntgipiltcdiwehayyidyrndrasyvkawwnlvnwnfanenlkkamqk
Timeline for d2bpib2: