Lineage for d2bpib2 (2bpi B:84-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946484Species Plasmodium falciparum [TaxId:36329] [225154] (1 PDB entry)
  8. 2946486Domain d2bpib2: 2bpi B:84-197 [203630]
    Other proteins in same PDB: d2bpia1, d2bpib1
    automated match to d1dt0a2
    complexed with fe

Details for d2bpib2

PDB Entry: 2bpi (more details), 2.52 Å

PDB Description: structure of iron dependent superoxide dismutase from p. falciparum.
PDB Compounds: (B:) fe-superoxide dismutase

SCOPe Domain Sequences for d2bpib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpib2 d.44.1.0 (B:84-197) automated matches {Plasmodium falciparum [TaxId: 36329]}
cggephgeikekiqedfgsfnnfkeqfsnilcghfgsgwgwlalnnnnklvilqthdagn
pikdntgipiltcdiwehayyidyrndrasyvkawwnlvnwnfanenlkkamqk

SCOPe Domain Coordinates for d2bpib2:

Click to download the PDB-style file with coordinates for d2bpib2.
(The format of our PDB-style files is described here.)

Timeline for d2bpib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bpib1