Lineage for d1qblh1 (1qbl H:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740181Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2740193Domain d1qblh1: 1qbl H:1-117 [20363]
    Other proteins in same PDB: d1qblh2, d1qbll1, d1qbll2
    part of anti-cytochrome c Fab E8

Details for d1qblh1

PDB Entry: 1qbl (more details), 2.26 Å

PDB Description: fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution
PDB Compounds: (H:) fabe8a

SCOPe Domain Sequences for d1qblh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qblh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky
dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgttltvss

SCOPe Domain Coordinates for d1qblh1:

Click to download the PDB-style file with coordinates for d1qblh1.
(The format of our PDB-style files is described here.)

Timeline for d1qblh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qblh2