SCOPe 2.08: Domain d2bp8b1: 2bp8 B:2-159

Lineage for d2bp8b1 (2bp8 B:2-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)

8. Domain d2bp8b1: 2bp8 B:2-159 [203625]
   automated match to d1gs7a1
   complexed with cu, so4, zn

Details for d2bp8b1

PDB Entry: 2bp8, 1.9 Å

PDB Description: m144q structure of nitrite reductase from alcaligenes xylosoxidans

PDB Compounds: (B:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2bp8b1:

Sequence; same for both SEQRES and ATOM records:

>d2bp8b1 b.6.1.3 (B:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgqsgtlmvlprdglkdp

Timeline for d2bp8b1:

• d2bp8b1 first appeared in SCOPe 2.03
  
• d2bp8b1 appears in SCOPe 2.07