Lineage for d2bp0a2 (2bp0 A:160-336)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303849Protein automated matches [226877] (2 species)
    not a true protein
  7. 1303850Species Achromobacter xylosoxidans [TaxId:85698] [225099] (5 PDB entries)
  8. 1303868Domain d2bp0a2: 2bp0 A:160-336 [203620]
    automated match to d1oe1a2
    complexed with cu, so4, zn; mutant

Details for d2bp0a2

PDB Entry: 2bp0 (more details), 1.9 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2bp0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp0a2 b.6.1.3 (A:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
egkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOPe Domain Coordinates for d2bp0a2:

Click to download the PDB-style file with coordinates for d2bp0a2.
(The format of our PDB-style files is described here.)

Timeline for d2bp0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bp0a1