![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries) |
![]() | Domain d2bova_: 2bov A: [203618] Other proteins in same PDB: d2bovb_ automated match to d2yinc_ complexed with gdp, mg |
PDB Entry: 2bov (more details), 2.66 Å
SCOPe Domain Sequences for d2bova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bova_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmedsk
Timeline for d2bova_: