Lineage for d1wejh1 (1wej H:1-112)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363002Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (28 PDB entries)
  8. 363003Domain d1wejh1: 1wej H:1-112 [20361]
    Other proteins in same PDB: d1wejf_, d1wejh2, d1wejl1, d1wejl2
    part of anti-cytochrome c Fab E8
    complexed with ace, hem, zn

Details for d1wejh1

PDB Entry: 1wej (more details), 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wejh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky
dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgtt

SCOP Domain Coordinates for d1wejh1:

Click to download the PDB-style file with coordinates for d1wejh1.
(The format of our PDB-style files is described here.)

Timeline for d1wejh1: