Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-cytochrome c Fab E8, (mouse), kappa L chain [48875] (3 PDB entries) |
Domain d1wejh1: 1wej H:1-112 [20361] Other proteins in same PDB: d1wejf_, d1wejh2, d1wejl2 |
PDB Entry: 1wej (more details), 1.8 Å
SCOP Domain Sequences for d1wejh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wejh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-cytochrome c Fab E8, (mouse), kappa L chain} evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgtt
Timeline for d1wejh1: