Lineage for d2bklb1 (2bkl B:2-412)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066340Family b.69.7.0: automated matches [227149] (1 protein)
    not a true family
  6. 2066341Protein automated matches [226853] (3 species)
    not a true protein
  7. 2066351Species Myxococcus xanthus [TaxId:34] [224965] (1 PDB entry)
  8. 2066353Domain d2bklb1: 2bkl B:2-412 [203609]
    Other proteins in same PDB: d2bkla2, d2bklb2
    automated match to d1e5ta1
    complexed with mes, so4, zah

Details for d2bklb1

PDB Entry: 2bkl (more details), 1.5 Å

PDB Description: structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
PDB Compounds: (B:) prolyl endopeptidase

SCOPe Domain Sequences for d2bklb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bklb1 b.69.7.0 (B:2-412) automated matches {Myxococcus xanthus [TaxId: 34]}
sypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfpgrealaa
rfkelfytdsvstpsrrngrffyvrthkdkekailywrqgesgqekvlldpngwskdgtv
slgtwavswdgkkvafaqkpnaadeavlhvidvdsgewskvdvieggkyatpkwtpdskg
fyyewlptdpsikvderpgyttiryhtlgtepskdtvvhertgdpttflqsdlsrdgkyl
fvyilrgwsendvywkrpgekdfrllvkgvgakyevhawkdrfyvltdegaprqrvfevd
pakparaswkeivpedssasllsvsivgghlsleylkdatsevrvatlkgkpvrtvqlpg
vgaasnlmgledlddayyvftsfttprqiyktsvstgkselwakvdvpmnp

SCOPe Domain Coordinates for d2bklb1:

Click to download the PDB-style file with coordinates for d2bklb1.
(The format of our PDB-style files is described here.)

Timeline for d2bklb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bklb2