Lineage for d2bkla1 (2bkl A:2-412)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326994Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1327351Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 1327408Family b.69.7.0: automated matches [227149] (1 protein)
    not a true family
  6. 1327409Protein automated matches [226853] (2 species)
    not a true protein
  7. 1327413Species Myxococcus xanthus [TaxId:34] [224965] (1 PDB entry)
  8. 1327414Domain d2bkla1: 2bkl A:2-412 [203607]
    Other proteins in same PDB: d2bkla2, d2bklb2
    automated match to d1e5ta1
    complexed with mes, so4, zah

Details for d2bkla1

PDB Entry: 2bkl (more details), 1.5 Å

PDB Description: structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d2bkla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkla1 b.69.7.0 (A:2-412) automated matches {Myxococcus xanthus [TaxId: 34]}
sypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfpgrealaa
rfkelfytdsvstpsrrngrffyvrthkdkekailywrqgesgqekvlldpngwskdgtv
slgtwavswdgkkvafaqkpnaadeavlhvidvdsgewskvdvieggkyatpkwtpdskg
fyyewlptdpsikvderpgyttiryhtlgtepskdtvvhertgdpttflqsdlsrdgkyl
fvyilrgwsendvywkrpgekdfrllvkgvgakyevhawkdrfyvltdegaprqrvfevd
pakparaswkeivpedssasllsvsivgghlsleylkdatsevrvatlkgkpvrtvqlpg
vgaasnlmgledlddayyvftsfttprqiyktsvstgkselwakvdvpmnp

SCOPe Domain Coordinates for d2bkla1:

Click to download the PDB-style file with coordinates for d2bkla1.
(The format of our PDB-style files is described here.)

Timeline for d2bkla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkla2