Lineage for d1wejl1 (1wej L:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288093Domain d1wejl1: 1wej L:1-107 [20360]
    Other proteins in same PDB: d1wejf_, d1wejh1, d1wejh2, d1wejl2
    part of anti-cytochrome c Fab E8
    complexed with ace, hem, zn

Details for d1wejl1

PDB Entry: 1wej (more details), 1.8 Å

PDB Description: igg1 fab fragment (of e8 antibody) complexed with horse cytochrome c at 1.8 a resolution

SCOP Domain Sequences for d1wejl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wejl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtkleik

SCOP Domain Coordinates for d1wejl1:

Click to download the PDB-style file with coordinates for d1wejl1.
(The format of our PDB-style files is described here.)

Timeline for d1wejl1: