SCOPe 2.03: Domain d2bgia2: 2bgi A:114-272

Lineage for d2bgia2 (2bgi A:114-272)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (12 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries)

8. Domain d2bgia2: 2bgi A:114-272 [203595]
   Other proteins in same PDB: d2bgia1
   automated match to d1a8pa2
   complexed with co2, fad, htg, so4

Details for d2bgia2

PDB Entry: 2bgi, 1.68 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus complexed with three molecules of the detergent n-heptyl- beta-d-thioglucoside at 1.7 angstroms

PDB Compounds: (A:) ferredoxin-nadp(h) reductase

SCOPe Domain Sequences for d2bgia2:

Sequence; same for both SEQRES and ATOM records:

>d2bgia2 c.25.1.0 (A:114-272) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal
qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg
slafnvdvmkvlesyglreganseprefvvekafvgegi

Timeline for d2bgia2:

• d2bgia2 is new in SCOPe 2.03-stable
  
• d2bgia2 appears in SCOPe 2.04
  
• d2bgia2 appears in the current release, SCOPe 2.08