Lineage for d2bgia2 (2bgi A:114-272)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2860013Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries)
  8. 2860014Domain d2bgia2: 2bgi A:114-272 [203595]
    Other proteins in same PDB: d2bgia1
    automated match to d1a8pa2
    complexed with co2, fad, htg, so4

Details for d2bgia2

PDB Entry: 2bgi (more details), 1.68 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus complexed with three molecules of the detergent n-heptyl- beta-d-thioglucoside at 1.7 angstroms
PDB Compounds: (A:) ferredoxin-nadp(h) reductase

SCOPe Domain Sequences for d2bgia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgia2 c.25.1.0 (A:114-272) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal
qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg
slafnvdvmkvlesyglreganseprefvvekafvgegi

SCOPe Domain Coordinates for d2bgia2:

Click to download the PDB-style file with coordinates for d2bgia2.
(The format of our PDB-style files is described here.)

Timeline for d2bgia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bgia1