SCOPe 2.06: Domain d2bgia1: 2bgi A:16-113

Lineage for d2bgia1 (2bgi A:16-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (20 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)

8. Domain d2bgia1: 2bgi A:16-113 [203594]
   Other proteins in same PDB: d2bgia2
   automated match to d1a8pa1
   complexed with co2, fad, htg, so4

Details for d2bgia1

PDB Entry: 2bgi, 1.68 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus complexed with three molecules of the detergent n-heptyl- beta-d-thioglucoside at 1.7 angstroms

PDB Compounds: (A:) ferredoxin-nadp(h) reductase

SCOPe Domain Sequences for d2bgia1:

Sequence; same for both SEQRES and ATOM records:

>d2bgia1 b.43.4.0 (A:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

Timeline for d2bgia1:

• d2bgia1 first appeared in SCOPe 2.03
  
• d2bgia1 appears in SCOPe 2.05
  
• d2bgia1 appears in SCOPe 2.07
  
• d2bgia1 appears in the current release, SCOPe 2.08