SCOPe 2.03: Domain d2bf3b_: 2bf3 B:

Lineage for d2bf3b_ (2bf3 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein automated matches [190214] (2 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [186971] (2 PDB entries)

8. Domain d2bf3b_: 2bf3 B: [203593]
   automated match to d2bf2b_
   complexed with hto

Details for d2bf3b_

PDB Entry: 2bf3, 1.96 Å

PDB Description: crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing ten n-terminal residues (delta-n10 t4mod)

PDB Compounds: (B:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d2bf3b_:

Sequence; same for both SEQRES and ATOM records:

>d2bf3b_ d.137.1.1 (B:) automated matches {Pseudomonas mendocina [TaxId: 300]}
nnvgpiirgdlvvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyf

Timeline for d2bf3b_:

• d2bf3b_ is new in SCOPe 2.03-stable
  
• d2bf3b_ appears in SCOPe 2.04
  
• d2bf3b_ appears in the current release, SCOPe 2.08