Lineage for d2bf3a_ (2bf3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978116Protein automated matches [190214] (3 species)
    not a true protein
  7. 2978132Species Pseudomonas mendocina [TaxId:300] [186971] (2 PDB entries)
  8. 2978133Domain d2bf3a_: 2bf3 A: [203592]
    automated match to d2bf2b_
    complexed with hto

Details for d2bf3a_

PDB Entry: 2bf3 (more details), 1.96 Å

PDB Description: crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing ten n-terminal residues (delta-n10 t4mod)
PDB Compounds: (A:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d2bf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bf3a_ d.137.1.1 (A:) automated matches {Pseudomonas mendocina [TaxId: 300]}
nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyf

SCOPe Domain Coordinates for d2bf3a_:

Click to download the PDB-style file with coordinates for d2bf3a_.
(The format of our PDB-style files is described here.)

Timeline for d2bf3a_: