Lineage for d2be7c1 (2be7 C:2-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156153Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2156456Species Moritella profunda [TaxId:111291] [225163] (1 PDB entry)
  8. 2156461Domain d2be7c1: 2be7 C:2-150 [203590]
    Other proteins in same PDB: d2be7d1, d2be7d2, d2be7e1, d2be7e2, d2be7f1, d2be7f2
    automated match to d1ekxa1
    complexed with so4, zn

Details for d2be7c1

PDB Entry: 2be7 (more details), 2.85 Å

PDB Description: crystal structure of the unliganded (t-state) aspartate transcarbamoylase of the psychrophilic bacterium moritella profunda
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2be7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be7c1 c.78.1.1 (C:2-150) Aspartate carbamoyltransferase catalytic subunit {Moritella profunda [TaxId: 111291]}
anplfrkhivsindisrnelelivktaaklkeqpqpellknkviascffeastrtrlsfe
taiqrlggsvigfdnagntslakkgetladsisvissyadafvmrhpqegaarlasefsn
vpvinggdgsnqhptqtlldlfsiyetqg

SCOPe Domain Coordinates for d2be7c1:

Click to download the PDB-style file with coordinates for d2be7c1.
(The format of our PDB-style files is described here.)

Timeline for d2be7c1: