SCOPe 2.05: Domain d2bc4d2: 2bc4 D:94-199

Lineage for d2bc4d2 (2bc4 D:94-199)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d2bc4d2: 2bc4 D:94-199 [203585]
Other proteins in same PDB: d2bc4a1, d2bc4b1, d2bc4c1, d2bc4d1
automated match to d1hdmb1
complexed with cl

Details for d2bc4d2

PDB Entry: 2bc4 (more details), 2.27 Å

PDB Description: crystal structure of hla-dm

PDB Compounds: (D:) HLA class II histocompatibility antigen, DM beta chain

SCOPe Domain Sequences for d2bc4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bc4d2 b.1.1.2 (D:94-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmphssahktaqpngd
wtyqtlshlaltpsygdtytcvvehigapepilrdwtpglspmqtl

SCOPe Domain Coordinates for d2bc4d2:

Click to download the PDB-style file with coordinates for d2bc4d2.
(The format of our PDB-style files is described here.)

Timeline for d2bc4d2: