SCOPe 2.05: Domain d2bc4d1: 2bc4 D:3-93

Lineage for d2bc4d1 (2bc4 D:3-93)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)

8. Domain d2bc4d1: 2bc4 D:3-93 [203584]
   Other proteins in same PDB: d2bc4a2, d2bc4b2, d2bc4c2, d2bc4d2
   automated match to d1hdmb2
   complexed with cl

Details for d2bc4d1

PDB Entry: 2bc4, 2.27 Å

PDB Description: crystal structure of hla-dm

PDB Compounds: (D:) HLA class II histocompatibility antigen, DM beta chain

SCOPe Domain Sequences for d2bc4d1:

Sequence; same for both SEQRES and ATOM records:

>d2bc4d1 d.19.1.1 (D:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsqhl
nqkdtlmqrlrnglqncathtqpfwgsltnr

Timeline for d2bc4d1:

• d2bc4d1 first appeared in SCOPe 2.03
  
• d2bc4d1 appears in SCOPe 2.04
  
• d2bc4d1 appears in SCOPe 2.06
  
• d2bc4d1 appears in the current release, SCOPe 2.08