Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d2bc4c2: 2bc4 C:97-206 [203583] Other proteins in same PDB: d2bc4a1, d2bc4b1, d2bc4c1, d2bc4d1 automated match to d1hdma1 complexed with cl |
PDB Entry: 2bc4 (more details), 2.27 Å
SCOPe Domain Sequences for d2bc4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bc4c2 b.1.1.2 (C:97-206) automated matches {Human (Homo sapiens) [TaxId: 9606]} srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwqhhsvpvegfgptfvsavdgl sfqafsylnftpepsdifscivtheidrytaiaywvprnalpsdlledyk
Timeline for d2bc4c2: