Lineage for d2bc4c2 (2bc4 C:97-203)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750616Domain d2bc4c2: 2bc4 C:97-203 [203583]
    Other proteins in same PDB: d2bc4a1, d2bc4b1, d2bc4c1, d2bc4c3, d2bc4d1
    automated match to d1hdma1
    complexed with cl

Details for d2bc4c2

PDB Entry: 2bc4 (more details), 2.27 Å

PDB Description: crystal structure of hla-dm
PDB Compounds: (C:) HLA class II histocompatibility antigen, DM alpha chain

SCOPe Domain Sequences for d2bc4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bc4c2 b.1.1.2 (C:97-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwqhhsvpvegfgptfvsavdgl
sfqafsylnftpepsdifscivtheidrytaiaywvprnalpsdlle

SCOPe Domain Coordinates for d2bc4c2:

Click to download the PDB-style file with coordinates for d2bc4c2.
(The format of our PDB-style files is described here.)

Timeline for d2bc4c2: