Lineage for d2bc4b1 (2bc4 B:3-93)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545619Protein automated matches [191280] (6 species)
    not a true protein
  7. 2545632Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)
  8. 2545668Domain d2bc4b1: 2bc4 B:3-93 [203580]
    Other proteins in same PDB: d2bc4a2, d2bc4b2, d2bc4c2, d2bc4c3, d2bc4d2
    automated match to d1hdmb2
    complexed with bma, cl, ndg

Details for d2bc4b1

PDB Entry: 2bc4 (more details), 2.27 Å

PDB Description: crystal structure of hla-dm
PDB Compounds: (B:) HLA class II histocompatibility antigen, DM beta chain

SCOPe Domain Sequences for d2bc4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bc4b1 d.19.1.1 (B:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsqhl
nqkdtlmqrlrnglqncathtqpfwgsltnr

SCOPe Domain Coordinates for d2bc4b1:

Click to download the PDB-style file with coordinates for d2bc4b1.
(The format of our PDB-style files is described here.)

Timeline for d2bc4b1: