![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries) |
![]() | Domain d2bc4b1: 2bc4 B:3-93 [203580] Other proteins in same PDB: d2bc4a2, d2bc4b2, d2bc4c2, d2bc4c3, d2bc4d2 automated match to d1hdmb2 complexed with bma, cl, ndg |
PDB Entry: 2bc4 (more details), 2.27 Å
SCOPe Domain Sequences for d2bc4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bc4b1 d.19.1.1 (B:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]} fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsqhl nqkdtlmqrlrnglqncathtqpfwgsltnr
Timeline for d2bc4b1: