Lineage for d1mnul1 (1mnu L:1-112)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287908Domain d1mnul1: 1mnu L:1-112 [20358]
    Other proteins in same PDB: d1mnuh1, d1mnuh2, d1mnul2
    part of bactericidal Fab MN12H2 against Neisseria meningitidis
    complexed with cd1

Details for d1mnul1

PDB Entry: 1mnu (more details), 2.5 Å

PDB Description: unliganded bactericidal antibody against neisseria meningitidis
PDB Compounds: (L:)

SCOP Domain Sequences for d1mnul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnul1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

SCOP Domain Coordinates for d1mnul1:

Click to download the PDB-style file with coordinates for d1mnul1.
(The format of our PDB-style files is described here.)

Timeline for d1mnul1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnul2