SCOPe 2.07: Domain d2bc4a1: 2bc4 A:13-96

Lineage for d2bc4a1 (2bc4 A:13-96)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d2bc4a1: 2bc4 A:13-96 [203578]
   Other proteins in same PDB: d2bc4a2, d2bc4b2, d2bc4c2, d2bc4c3, d2bc4d2
   automated match to d1hdma2
   complexed with bma, cl, ndg

Details for d2bc4a1

PDB Entry: 2bc4, 2.27 Å

PDB Description: crystal structure of hla-dm

PDB Compounds: (A:) HLA class II histocompatibility antigen, DM alpha chain

SCOPe Domain Sequences for d2bc4a1:

Sequence; same for both SEQRES and ATOM records:

>d2bc4a1 d.19.1.1 (A:13-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdapai
lfdkefcewmiqqigpkldgkipv

Timeline for d2bc4a1:

• d2bc4a1 first appeared in SCOPe 2.03
  
• d2bc4a1 appears in SCOPe 2.06
  
• d2bc4a1 appears in the current release, SCOPe 2.08