SCOPe 2.05: Domain d2bbwb2: 2bbw B:126-161

Lineage for d2bbwb2 (2bbw B:126-161)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.0: automated matches [227167] (1 protein)
   not a true family

6. Protein automated matches [226876] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225040] (3 PDB entries)

8. Domain d2bbwb2: 2bbw B:126-161 [203577]
   Other proteins in same PDB: d2bbwa1, d2bbwb1
   automated match to d2ak3a2
   complexed with gp5

Details for d2bbwb2

PDB Entry: 2bbw, 2.05 Å

PDB Description: Crystal structure of human adenylate kinase 4 (AK4) in complex with diguanosine pentaphosphate

PDB Compounds: (B:) adenylate kinase 4, AK4

SCOPe Domain Sequences for d2bbwb2:

Sequence; same for both SEQRES and ATOM records:

>d2bbwb2 g.41.2.0 (B:126-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwihppsgrvynldfnpphvhgiddvtgeplvqqed

Timeline for d2bbwb2:

• d2bbwb2 first appeared in SCOPe 2.03
  
• d2bbwb2 appears in SCOPe 2.04
  
• d2bbwb2 appears in SCOPe 2.06
  
• d2bbwb2 appears in the current release, SCOPe 2.08