| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (130 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries) |
| Domain d2bbwa1: 2bbw A:4-125,A:162-223 [203574] Other proteins in same PDB: d2bbwa2, d2bbwb2 automated match to d2ak3a1 complexed with gp5 |
PDB Entry: 2bbw (more details), 2.05 Å
SCOPe Domain Sequences for d2bbwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bbwa1 c.37.1.0 (A:4-125,A:162-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
srXdkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
skeay
Timeline for d2bbwa1: