Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225033] (1 PDB entry) |
Domain d2b94a1: 2b94 A:-2-241 [203573] Other proteins in same PDB: d2b94a2 automated match to d3emva_ complexed with thj |
PDB Entry: 2b94 (more details), 1.85 Å
SCOPe Domain Sequences for d2b94a1:
Sequence, based on SEQRES records: (download)
>d2b94a1 c.56.2.1 (A:-2-241) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]} eeemqrhikltpsqttpvvlvvgdpgrvdkvkmlcdsyvdlaynreyksvectykgqkfl cvshgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaavredrvshl miysdfpavadfevydtlnkvaqelevpvfngislssdlyyphkiiptrledyskanvav vemevatlmvmgtlrkvktggifivdgcplkwdegdfdnnlvpeklenmikisletcarl akky
>d2b94a1 c.56.2.1 (A:-2-241) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]} eeemqrhikltpsqttpvvlvvgdpgrvdkvkmlcdsyvdlaeyksvectykgqkflcvs hgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaavredrvshlmiy sdfpavadfevydtlnkvaqelevpvfngislssdlyyphkiiptrledyskanvavvem evatlmvmgtlrkvktggifivdgcplkwnlvpeklenmikisletcarlakky
Timeline for d2b94a1: