Lineage for d2b7pb2 (2b7p B:103-273)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839839Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 2839840Protein automated matches [226879] (8 species)
    not a true protein
  7. 2839849Species Helicobacter pylori [TaxId:210] [225051] (2 PDB entries)
  8. 2839854Domain d2b7pb2: 2b7p B:103-273 [203570]
    Other proteins in same PDB: d2b7pa1, d2b7pb1, d2b7pc1
    automated match to d1qapa1
    complexed with pht, so4

Details for d2b7pb2

PDB Entry: 2b7p (more details), 2.51 Å

PDB Description: crystal structure of quinolinic acid phosphoribosyltransferase from helicobacter pylori with phthalic acid
PDB Compounds: (B:) Probable nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d2b7pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7pb2 c.1.17.0 (B:103-273) automated matches {Helicobacter pylori [TaxId: 210]}
iatltsrfvealnshkvrlldtrktrpllrifekysvlnggasnhrlglddalmlkdthl
rhvkdlksfltharknlpftakieiecesfeeaknamnagadivmcdnlsvletkeiaay
rdahypfvlleasgnislesinayaksgvdaisvgalihqatfidmhmkma

SCOPe Domain Coordinates for d2b7pb2:

Click to download the PDB-style file with coordinates for d2b7pb2.
(The format of our PDB-style files is described here.)

Timeline for d2b7pb2: