| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (2 PDB entries) |
| Domain d2mpah1: 2mpa H:1-121 [20357] Other proteins in same PDB: d2mpah2, d2mpal2 |
PDB Entry: 2mpa (more details), 2.6 Å
SCOP Domain Sequences for d2mpah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mpah1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
s
Timeline for d2mpah1: