SCOP 1.63: Domain d2mpal1: 2mpa L:1-112

Lineage for d2mpal1 (2mpa L:1-112)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries)
   against Neisseria meningitidis

8. Domain d2mpal1: 2mpa L:1-112 [20356]
   Other proteins in same PDB: d2mpah2, d2mpal2

Details for d2mpal1

PDB Entry: 2mpa, 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d2mpal1:

Sequence; same for both SEQRES and ATOM records:

>d2mpal1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

Timeline for d2mpal1:

• d2mpal1 first appeared (with stable ids) in SCOP 1.55
  
• d2mpal1 appears in SCOP 1.61
  
• d2mpal1 appears in SCOP 1.65
  
• d2mpal1 appears in the current release, SCOPe 2.08