SCOPe 2.08: Domain d2b5oa2: 2b5o A:243-402

Lineage for d2b5oa2 (2b5o A:243-402)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Synechococcus sp. [TaxId:32049] [225028] (1 PDB entry)

8. Domain d2b5oa2: 2b5o A:243-402 [203558]
   Other proteins in same PDB: d2b5oa1, d2b5ob1
   automated match to d1frna2
   complexed with fad, so4

Details for d2b5oa2

PDB Entry: 2b5o, 2.5 Å

PDB Description: ferredoxin-nadp reductase

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d2b5oa2:

Sequence; same for both SEQRES and ATOM records:

>d2b5oa2 c.25.1.0 (A:243-402) automated matches {Synechococcus sp. [TaxId: 32049]}
mllpddedatvvmlatgtgiapfraflwrmfkeqhedykfkgkawlifgvpytanilykd
dfekmaaenpdnfrltyaisreqktadggkvyvqsrvseyadelfemiqkpnthvymcgl
kgmqppidetftaeaekrglnweemrrsmkkehrwhvevy

Timeline for d2b5oa2:

• d2b5oa2 first appeared in SCOPe 2.03
  
• d2b5oa2 appears in SCOPe 2.07