SCOPe 2.04: Domain d2b56a1: 2b56 A:30-288

Lineage for d2b56a1 (2b56 A:30-288)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.10: RNA editing terminal uridyl transferase 2, RET2, catalytic domain [143236] (1 protein)
   contains insert domain of a ferredoxin-like fold

6. Protein RNA editing terminal uridyl transferase 2, TUTase 2, RET2 [143237] (1 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143238] (3 PDB entries)
   Uniprot Q86MV5 30-288

8. Domain d2b56a1: 2b56 A:30-288 [203555]
   Other proteins in same PDB: d2b56a2
   automated match to d2b4va2
   protein/RNA complex; complexed with mg, u5p, utp

Details for d2b56a1

PDB Entry: 2b56, 1.97 Å

PDB Description: structural basis for utp specificity of rna editing tutases from trypanosoma brucei

PDB Compounds: (A:) RNA editing complex protein MP57

SCOPe Domain Sequences for d2b56a1:

Sequence; same for both SEQRES and ATOM records:

>d2b56a1 d.218.1.10 (A:30-288) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
npspdhyavwgkaimaennrrvgpehmfrtairaqqqlqgladkwtpdakvyccgsmvty
gqmergsdldlacmfddpypshevqakrtdklrtvikryvphylrnnllglteartpvvk
lrfandekvararytplseeedrkartalldvrnqcvgdndveyiaekmgrdnvegirvd
rttygcriaiqctskeqmieaigffpdgkimtrgmredytrdvldvrfvpemfmyrwdis
fvgygvknsylirhylhng

Timeline for d2b56a1:

• d2b56a1 first appeared in SCOPe 2.03
  
• d2b56a1 appears in SCOPe 2.05
  
• d2b56a1 appears in the current release, SCOPe 2.08