SCOPe 2.08: Domain d2b51a2: 2b51 A:289-473

Lineage for d2b51a2 (2b51 A:289-473)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.4: RNA editing terminal uridyl transferase 2, RET2, domain 2 [140679] (1 protein)

6. Protein RNA editing terminal uridyl transferase 2, TUTase 2, RET2 [140680] (1 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [140681] (3 PDB entries)
   Uniprot Q86MV5 289-471

8. Domain d2b51a2: 2b51 A:289-473 [203554]
   Other proteins in same PDB: d2b51a1
   automated match to d2b4va1
   protein/RNA complex; complexed with mn, utp

Details for d2b51a2

PDB Entry: 2b51, 2.05 Å

PDB Description: structural basis for utp specificity of rna editing tutases from trypanosoma brucei

PDB Compounds: (A:) RNA editing complex protein MP57

SCOPe Domain Sequences for d2b51a2:

Sequence; same for both SEQRES and ATOM records:

>d2b51a2 a.160.1.4 (A:289-473) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
pvaarhtamavkawgkatnvgagsgamltsyavtvmfiyyllvtrqvlwvdpwslphpah
lprypdfsplydcdptelgrllhgffifyahhfdyerevvslnrnrrsyrsdigwnfpqn
kkgtfsynfciedpyedvgtgglnlvrhlhpakfqlvkqeflraaqcmerflptnapeks
ilgvk

Timeline for d2b51a2:

• d2b51a2 first appeared in SCOPe 2.03
  
• d2b51a2 appears in SCOPe 2.07