Lineage for d2b51a1 (2b51 A:30-288)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007318Family d.218.1.10: RNA editing terminal uridyl transferase 2, RET2, catalytic domain [143236] (1 protein)
    contains insert domain of a ferredoxin-like fold
  6. 3007319Protein RNA editing terminal uridyl transferase 2, TUTase 2, RET2 [143237] (1 species)
  7. 3007320Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143238] (3 PDB entries)
    Uniprot Q86MV5 30-288
  8. 3007323Domain d2b51a1: 2b51 A:30-288 [203553]
    Other proteins in same PDB: d2b51a2
    automated match to d2b4va2
    protein/RNA complex; complexed with mn, utp

Details for d2b51a1

PDB Entry: 2b51 (more details), 2.05 Å

PDB Description: structural basis for utp specificity of rna editing tutases from trypanosoma brucei
PDB Compounds: (A:) RNA editing complex protein MP57

SCOPe Domain Sequences for d2b51a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b51a1 d.218.1.10 (A:30-288) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
npspdhyavwgkaimaennrrvgpehmfrtairaqqqlqgladkwtpdakvyccgsmvty
gqmergsdldlacmfddpypshevqakrtdklrtvikryvphylrnnllglteartpvvk
lrfandekvararytplseeedrkartalldvrnqcvgdndveyiaekmgrdnvegirvd
rttygcriaiqctskeqmieaigffpdgkimtrgmredytrdvldvrfvpemfmyrwdis
fvgygvknsylirhylhng

SCOPe Domain Coordinates for d2b51a1:

Click to download the PDB-style file with coordinates for d2b51a1.
(The format of our PDB-style files is described here.)

Timeline for d2b51a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b51a2