Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins) |
Protein automated matches [226916] (1 species) not a true protein |
Species Selenomonas ruminantium [TaxId:971] [225167] (4 PDB entries) |
Domain d2b4ua_: 2b4u A: [203551] automated match to d1u24a_ complexed with cl, mli, so4; mutant |
PDB Entry: 2b4u (more details), 2 Å
SCOPe Domain Sequences for d2b4ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4ua_ c.45.1.4 (A:) automated matches {Selenomonas ruminantium [TaxId: 971]} tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag mryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlknps vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt pwsvwlkshpakal
Timeline for d2b4ua_: