| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries) |
| Domain d2f58h1: 2f58 H:1-113 [20355] Other proteins in same PDB: d2f58h2, d2f58l2 |
PDB Entry: 2f58 (more details), 2.8 Å
SCOP Domain Sequences for d2f58h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f58h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss
Timeline for d2f58h1: