SCOPe 2.08: Domain d2b4pa1: 2b4p A:34-346

Lineage for d2b4pa1 (2b4p A:34-346)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)

6. Protein automated matches [226916] (1 species)
   not a true protein

7. Species Selenomonas ruminantium [TaxId:971] [225167] (4 PDB entries)

8. Domain d2b4pa1: 2b4p A:34-346 [203547]
   Other proteins in same PDB: d2b4pa2
   automated match to d3mmjb_
   complexed with cl, mli; mutant

Details for d2b4pa1

PDB Entry: 2b4p, 1.81 Å

PDB Description: structure of the d223n mutant of selenomonas ruminantium ptp-like phytase

PDB Compounds: (A:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d2b4pa1:

Sequence; same for both SEQRES and ATOM records:

>d2b4pa1 c.45.1.4 (A:34-346) automated matches {Selenomonas ruminantium [TaxId: 971]}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatnhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpaka

Timeline for d2b4pa1:

• d2b4pa1 first appeared in SCOPe 2.03, called d2b4pa_
  
• d2b4pa1 appears in SCOPe 2.07