SCOPe 2.05: Domain d2b4oa_: 2b4o A:

Lineage for d2b4oa_ (2b4o A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)

6. Protein automated matches [226916] (1 species)
   not a true protein

7. Species Selenomonas ruminantium [TaxId:971] [225167] (6 PDB entries)

8. Domain d2b4oa_: 2b4o A: [203545]
   automated match to d3mmjb_
   complexed with cl, gol; mutant

Details for d2b4oa_

PDB Entry: 2b4o, 2.3 Å

PDB Description: structure of the r258k mutant of selenomonas ruminantium ptp-like phytase

PDB Compounds: (A:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d2b4oa_:

Sequence; same for both SEQRES and ATOM records:

>d2b4oa_ c.45.1.4 (A:) automated matches {Selenomonas ruminantium [TaxId: 971]}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgkttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpaka

Timeline for d2b4oa_:

• d2b4oa_ first appeared in SCOPe 2.03
  
• d2b4oa_ appears in SCOPe 2.04
  
• d2b4oa_ appears in SCOPe 2.06
  
• d2b4oa_ appears in the current release, SCOPe 2.08