Lineage for d2b4oa_ (2b4o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875718Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)
  6. 2875746Protein automated matches [226916] (1 species)
    not a true protein
  7. 2875747Species Selenomonas ruminantium [TaxId:971] [225167] (4 PDB entries)
  8. 2875754Domain d2b4oa_: 2b4o A: [203545]
    automated match to d3mmjb_
    complexed with cl, gol; mutant

Details for d2b4oa_

PDB Entry: 2b4o (more details), 2.3 Å

PDB Description: structure of the r258k mutant of selenomonas ruminantium ptp-like phytase
PDB Compounds: (A:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d2b4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4oa_ c.45.1.4 (A:) automated matches {Selenomonas ruminantium [TaxId: 971]}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgkttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpaka

SCOPe Domain Coordinates for d2b4oa_:

Click to download the PDB-style file with coordinates for d2b4oa_.
(The format of our PDB-style files is described here.)

Timeline for d2b4oa_: