Lineage for d2f58l1 (2f58 L:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451954Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (24 PDB entries)
  8. 451972Domain d2f58l1: 2f58 L:1-107 [20354]
    Other proteins in same PDB: d2f58h1, d2f58h2, d2f58l2
    part of anti-gp120 (HIV-1) Fab 58.2

Details for d2f58l1

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelk

SCOP Domain Coordinates for d2f58l1:

Click to download the PDB-style file with coordinates for d2f58l1.
(The format of our PDB-style files is described here.)

Timeline for d2f58l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58l2