SCOP 1.57: Domain d2f58l1: 2f58 L:1-107

Lineage for d2f58l1 (2f58 L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries)

8. Domain d2f58l1: 2f58 L:1-107 [20354]
   Other proteins in same PDB: d2f58h2, d2f58l2

Details for d2f58l1

PDB Entry: 2f58, 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58l1:

Sequence; same for both SEQRES and ATOM records:

>d2f58l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelk

Timeline for d2f58l1:

• d2f58l1 first appeared (with stable ids) in SCOP 1.55
  
• d2f58l1 appears in SCOP 1.59
  
• d2f58l1 appears in the current release, SCOPe 2.08