Lineage for d2b1ma_ (2b1m A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889773Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1889774Protein automated matches [190230] (17 species)
    not a true protein
  7. 1889871Species Pachyrhizus erosus [TaxId:109171] [225133] (1 PDB entry)
  8. 1889872Domain d2b1ma_: 2b1m A: [203539]
    automated match to d1s4vb_
    complexed with peg, pg4

Details for d2b1ma_

PDB Entry: 2b1m (more details), 2 Å

PDB Description: crystal structure of a papain-fold protein without the catalytic cysteine from seeds of pachyrhizus erosus
PDB Compounds: (A:) spe31

SCOPe Domain Sequences for d2b1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1ma_ d.3.1.0 (A:) automated matches {Pachyrhizus erosus [TaxId: 109171]}
apeswdwskkgvitkvkfqgqcgsgwafsatgaieaahaiatgnlvslseqelidcvdes
egcyngwhyqsfewvvkhggiaseadypykardgkckaneiqdkvtidnygvqilsnest
eseaesslqsfvleqpisvsidakdfhfysggiydggncsspyginhfvlivgygsedgv
dywiaknswgedwgidgyiriqrntgnllgvcgmnyfasypiiek

SCOPe Domain Coordinates for d2b1ma_:

Click to download the PDB-style file with coordinates for d2b1ma_.
(The format of our PDB-style files is described here.)

Timeline for d2b1ma_: