Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (17 species) not a true protein |
Species Pachyrhizus erosus [TaxId:109171] [225133] (1 PDB entry) |
Domain d2b1ma_: 2b1m A: [203539] automated match to d1s4vb_ complexed with peg, pg4 |
PDB Entry: 2b1m (more details), 2 Å
SCOPe Domain Sequences for d2b1ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1ma_ d.3.1.0 (A:) automated matches {Pachyrhizus erosus [TaxId: 109171]} apeswdwskkgvitkvkfqgqcgsgwafsatgaieaahaiatgnlvslseqelidcvdes egcyngwhyqsfewvvkhggiaseadypykardgkckaneiqdkvtidnygvqilsnest eseaesslqsfvleqpisvsidakdfhfysggiydggncsspyginhfvlivgygsedgv dywiaknswgedwgidgyiriqrntgnllgvcgmnyfasypiiek
Timeline for d2b1ma_: