Lineage for d2b1ib1 (2b1i B:4-200)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1358940Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1358941Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 1359031Family c.24.1.3: Inosicase [63971] (1 protein)
  6. 1359032Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)
  7. 1359033Species Chicken (Gallus gallus) [TaxId:9031] [63973] (8 PDB entries)
    Uniprot P31335
  8. 1359041Domain d2b1ib1: 2b1i B:4-200 [203537]
    Other proteins in same PDB: d2b1ia2, d2b1ib2
    automated match to d1g8ma1
    complexed with 93a, k

Details for d2b1ib1

PDB Entry: 2b1i (more details), 2.02 Å

PDB Description: crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
PDB Compounds: (B:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d2b1ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1ib1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk

SCOPe Domain Coordinates for d2b1ib1:

Click to download the PDB-style file with coordinates for d2b1ib1.
(The format of our PDB-style files is described here.)

Timeline for d2b1ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b1ib2