Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) contains a common phosphate-binding site |
Family c.24.1.3: Inosicase [63971] (1 protein) |
Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [63973] (8 PDB entries) Uniprot P31335 |
Domain d2b1ib1: 2b1i B:4-200 [203537] Other proteins in same PDB: d2b1ia2, d2b1ib2 automated match to d1g8ma1 complexed with 93a, k |
PDB Entry: 2b1i (more details), 2.02 Å
SCOPe Domain Sequences for d2b1ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1ib1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht aqydaaisdyfrkeysk
Timeline for d2b1ib1: