| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
| Family c.24.1.3: Inosicase [63971] (1 protein) |
| Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [63973] (9 PDB entries) Uniprot P31335 |
| Domain d2b1gc1: 2b1g C:4-200 [203531] Other proteins in same PDB: d2b1ga2, d2b1gb2, d2b1gc2, d2b1gd2 automated match to d1g8ma1 complexed with 13a, k, po4 |
PDB Entry: 2b1g (more details), 2.1 Å
SCOPe Domain Sequences for d2b1gc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1gc1 c.24.1.3 (C:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk
Timeline for d2b1gc1: