SCOP 1.61: Domain d3f58h1: 3f58 H:1-113

Lineage for d3f58h1 (3f58 H:1-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [48873] (3 PDB entries)

8. Domain d3f58h1: 3f58 H:1-113 [20353]
   Other proteins in same PDB: d3f58h2, d3f58l2

Details for d3f58h1

PDB Entry: 3f58, 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation

SCOP Domain Sequences for d3f58h1:

Sequence; same for both SEQRES and ATOM records:

>d3f58h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvss

Timeline for d3f58h1:

• d3f58h1 first appeared (with stable ids) in SCOP 1.55
  
• d3f58h1 appears in SCOP 1.59
  
• d3f58h1 appears in SCOP 1.63
  
• d3f58h1 appears in the current release, SCOPe 2.08