| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins) duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs |
| Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [64200] (9 PDB entries) Uniprot P31335 |
| Domain d2b1ga2: 2b1g A:201-593 [203528] Other proteins in same PDB: d2b1ga1, d2b1gb1, d2b1gc1, d2b1gd1 automated match to d1g8ma2 complexed with 13a, k, po4 |
PDB Entry: 2b1g (more details), 2.1 Å
SCOPe Domain Sequences for d2b1ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1ga2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh
Timeline for d2b1ga2: