![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
![]() | Protein automated matches [191267] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189837] (14 PDB entries) |
![]() | Domain d2b0oh2: 2b0o H:547-694 [203526] Other proteins in same PDB: d2b0oe1, d2b0of1, d2b0og1, d2b0oh1 automated match to d1dcqa1 complexed with zn |
PDB Entry: 2b0o (more details), 2.06 Å
SCOPe Domain Sequences for d2b0oh2:
Sequence, based on SEQRES records: (download)
>d2b0oh2 d.211.1.0 (H:547-694) automated matches {Human (Homo sapiens) [TaxId: 9606]} epqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeelvlhlavkvanqaslplvd fiiqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkh hkeceelleqaqagtfafplhvdyswvi
>d2b0oh2 d.211.1.0 (H:547-694) automated matches {Human (Homo sapiens) [TaxId: 9606]} epqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqng ghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkecee lleqaqagtfafplhvdyswvi
Timeline for d2b0oh2: