Lineage for d2b0oh2 (2b0o H:547-694)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445942Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1445943Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1446071Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1446072Protein automated matches [191267] (3 species)
    not a true protein
  7. 1446078Species Human (Homo sapiens) [TaxId:9606] [189837] (14 PDB entries)
  8. 1446106Domain d2b0oh2: 2b0o H:547-694 [203526]
    Other proteins in same PDB: d2b0oe1, d2b0of1, d2b0og1, d2b0oh1
    automated match to d1dcqa1
    complexed with zn

Details for d2b0oh2

PDB Entry: 2b0o (more details), 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain
PDB Compounds: (H:) uplc1

SCOPe Domain Sequences for d2b0oh2:

Sequence, based on SEQRES records: (download)

>d2b0oh2 d.211.1.0 (H:547-694) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeelvlhlavkvanqaslplvd
fiiqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkh
hkeceelleqaqagtfafplhvdyswvi

Sequence, based on observed residues (ATOM records): (download)

>d2b0oh2 d.211.1.0 (H:547-694) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqng
ghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkecee
lleqaqagtfafplhvdyswvi

SCOPe Domain Coordinates for d2b0oh2:

Click to download the PDB-style file with coordinates for d2b0oh2.
(The format of our PDB-style files is described here.)

Timeline for d2b0oh2: