Lineage for d2b0oh1 (2b0o H:424-543)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967089Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 1967090Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) (S)
  5. 1967102Family g.45.1.0: automated matches [227161] (1 protein)
    not a true family
  6. 1967103Protein automated matches [226869] (1 species)
    not a true protein
  7. 1967104Species Human (Homo sapiens) [TaxId:9606] [225018] (1 PDB entry)
  8. 1967108Domain d2b0oh1: 2b0o H:424-543 [203525]
    Other proteins in same PDB: d2b0oe2, d2b0of2, d2b0og2, d2b0oh2
    automated match to d1dcqa2
    complexed with zn

Details for d2b0oh1

PDB Entry: 2b0o (more details), 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain
PDB Compounds: (H:) uplc1

SCOPe Domain Sequences for d2b0oh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0oh1 g.45.1.0 (H:424-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqsltl
dllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrfarr

SCOPe Domain Coordinates for d2b0oh1:

Click to download the PDB-style file with coordinates for d2b0oh1.
(The format of our PDB-style files is described here.)

Timeline for d2b0oh1: